DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP001419

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_003435823.1 Gene:AgaP_AGAP001419 / 1281757 VectorBaseID:AGAP001419 Length:532 Species:Anopheles gambiae


Alignment Length:203 Identity:52/203 - (25%)
Similarity:107/203 - (52%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSIDNKAVYDTF-SVFGNILNCNV--AKDEDGNSRGYGFVHFDSEEAARA 168
            |.|..:.::::.|:.:|...:.:.|.| .:...::...:  :.|:...:||:.|:.::|.:||..
Mosquito   243 NVSVPNLRLFVGNIPKSKGKEEILDEFGKLTAGLVEVIIYSSPDDKKKNRGFCFLEYESHKAASL 307

  Fly   169 AIEKV-NGMLCNNQKVHVVKFI-----PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYG 227
            |..:: .|.:    ||.....|     |:.:.:::..:..|.|||:||:::.:|:.|:|.||.:|
Mosquito   308 AKRRLGTGRI----KVWNCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDTSEEKLKESFEQFG 368

  Fly   228 RITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL-GDNKFLYVARALSKAERQQEINR 291
            |:...|.:.|       :.||.:|:..:|:.|:..|.||:: |.|..:.:|:..|..::::||.|
Mosquito   369 RVERVKKIKD-------YAFVHFEDRDNAVKAMKDLDGKEVGGSNIEVSLAKPPSDKKKKEEILR 426

  Fly   292 KLEERKRQ 299
            ..|.|..|
Mosquito   427 ARERRMTQ 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/73 (21%)
RRM3_I_PABPs 202..282 CDD:240826 26/80 (33%)
AgaP_AGAP001419XP_003435823.1 RRM1_hnRNPR_like 167..245 CDD:240695 1/1 (100%)
RRM2_hnRNPR_like 248..329 CDD:240696 16/84 (19%)
RRM3_hnRNPR_like 343..414 CDD:240697 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.