DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP001538

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_321584.5 Gene:AgaP_AGAP001538 / 1281638 VectorBaseID:AGAP001538 Length:408 Species:Anopheles gambiae


Alignment Length:191 Identity:53/191 - (27%)
Similarity:94/191 - (49%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            ||:..|:..:....:::.|...|.::|.::.||. ....:|||||.|..||.|..||:.:|    
Mosquito    15 IYVGGLDDKVTETLLWELFVQSGPVVNVHMPKDRVTQMHQGYGFVEFLGEEDADYAIKIMN---- 75

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFK------NLYVKNLSEEFTEQHLREMFEPYGRI-TSHKLML 236
                  ::|...:..|..:.:.|.|      |:::.||..|..|:.|.:.|..:|.| .:.|:|.
Mosquito    76 ------MIKLYGKPIRVNKASAHQKSLDVGANIFIGNLDLEVDEKLLYDTFSAFGVILQTPKIMR 134

  Fly   237 D-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARAL---SKAERQQEINRKL 293
            | |.|.|:.|.|:.:.:.:::.||:..::|:.| .|:.:.|:.|.   ||.||......:|
Mosquito   135 DPETGNSKGFAFINFASFEASDAAMDAMNGQYL-CNRPISVSYAFKKDSKGERHGSAAERL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/70 (29%)
RRM3_I_PABPs 202..282 CDD:240826 25/90 (28%)
AgaP_AGAP001538XP_321584.5 RRM1_SF3B4 15..88 CDD:240780 22/82 (27%)
RRM2_SF3B4 99..181 CDD:240781 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.