DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP001643

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_321453.3 Gene:AgaP_AGAP001643 / 1281529 VectorBaseID:AGAP001643 Length:1196 Species:Anopheles gambiae


Alignment Length:160 Identity:34/160 - (21%)
Similarity:68/160 - (42%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFD--SEEAARAA 169
            |:......:::.|:...:..:.:.|.|:.:|.:.|.:.|:     .:.:|.|:|:  :.:.|..|
Mosquito  1034 NTKHQKHTVFVGNVNSKMSEREIEDIFARYGRLENVDFAR-----RKRFGEVYFNYSNRDHAFKA 1093

  Fly   170 IEKVNGMLCNNQKVHVVKFIPRRDR---EQEKATHFKNLYV-KNLSEEFTEQHLREMFEPYGRIT 230
            :|..|           ||.:.||.|   ..||..|.:...: ..:.:...||.:.:.:|.||.|.
Mosquito  1094 LEMNN-----------VKIMGRRLRVSFNSEKPIHREGYTIYYTMRQPTDEQTIYQSYESYGEID 1147

  Fly   231 SHKLMLDEEGRSRRFGFVAYENPQSALAAV 260
            .  :...:.|   .||.:.:...:||..|:
Mosquito  1148 F--IWYPDNG---LFGTITFRRAESATEAL 1172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 13/71 (18%)
RRM3_I_PABPs 202..282 CDD:240826 12/60 (20%)
AgaP_AGAP001643XP_321453.3 RRM_SF 7..77 CDD:240668
RRM <90..>199 CDD:223796
RRM_SF 92..157 CDD:240668
RRM_SF 281..339 CDD:240668
RRM_SF 504..573 CDD:240668
EBP50_C <764..840 CDD:286142
RRM_SF 1042..1109 CDD:240668 18/82 (22%)
RRM_SF 1131..1184 CDD:302621 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.