DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP001883

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_321180.5 Gene:AgaP_AGAP001883 / 1281239 VectorBaseID:AGAP001883 Length:396 Species:Anopheles gambiae


Alignment Length:198 Identity:58/198 - (29%)
Similarity:98/198 - (49%) Gaps:21/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 HSANVGVGVGGG----ALASGSTGGSGGNSSPDSGK--IYIKNLERSIDNKAVYDTFSVFGNILN 141
            :.||.|.|.|||    .:|.|:.|| ||.||.::.:  :.:..|.:::..:.:...||..|.:.:
Mosquito    39 NGANGGGGGGGGEAGQTVAGGAAGG-GGQSSDNNSRTNLIVNYLPQTMTEEEIRSLFSSVGEVES 102

  Fly   142 CNVAKDED--------GNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEK 198
            ..:.:|::        |.|.|||||::...:.|..|:..:||:...| ||..|.|.    |...:
Mosquito   103 VKLVRDKNVIYPGQPKGQSLGYGFVNYHRPQDAEQAVNVLNGLRLQN-KVLKVSFA----RPSSE 162

  Fly   199 ATHFKNLYVKNLSEEFTEQHLREMFEPYGR-ITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIG 262
            .....|||:..|.:..|::.|..:|.|||. |||..|:.|...:.:..||:.::..:.|..|:..
Mosquito   163 GIKGANLYISGLPKTITQEELETIFRPYGEIITSRVLIQDGNDKPKGVGFIRFDQRKEAERAIQA 227

  Fly   263 LHG 265
            |:|
Mosquito   228 LNG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/77 (25%)
RRM3_I_PABPs 202..282 CDD:240826 21/65 (32%)
AgaP_AGAP001883XP_321180.5 ELAV_HUD_SF 71..396 CDD:273741 43/165 (26%)
RRM1_Hu 73..157 CDD:241094 20/84 (24%)
RRM2_Hu 167..245 CDD:241096 21/64 (33%)
RRM3_Hu 314..391 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.