DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP001930

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_003435970.1 Gene:AgaP_AGAP001930 / 1281194 VectorBaseID:AGAP001930 Length:412 Species:Anopheles gambiae


Alignment Length:175 Identity:51/175 - (29%)
Similarity:83/175 - (47%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DSGKIYIKNL--ERSIDNKAVYDTFSVFGNILNCNVAK-DEDGNSRGYGFVHFDSEEAARAAIEK 172
            :.||:::..|  |.|.:|...|  ||.:|.:::|.|.| :|.|.|||:|||.|...|....|:|.
Mosquito    16 EKGKLFVGGLSWETSHENLQRY--FSRYGEVIDCVVMKNNETGRSRGFGFVTFADPENVERALEN 78

  Fly   173 ---------VNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGR 228
                     ::...||          ||...:.::...:..:::..|....||..||..|..||.
Mosquito    79 GPHTLDGRTIDPKPCN----------PRSQHKPKRTGGYPKVFLGGLPPNITETDLRSFFCRYGT 133

  Fly   229 ITSHKLMLDEE-GRSRRFGFVAYENPQSALAAV----IGLHGKQL 268
            :....:|.|:| .:||.|||:::||..:...|.    :.:.|||:
Mosquito   134 VMEVVIMYDQEKKKSRGFGFLSFENESAVERATTDHFVHISGKQV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 25/81 (31%)
RRM3_I_PABPs 202..282 CDD:240826 22/72 (31%)
AgaP_AGAP001930XP_003435970.1 RRM_SF 19..100 CDD:302621 28/92 (30%)
RRM2_DAZAP1 106..185 CDD:240773 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.