DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP001993

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_321067.5 Gene:AgaP_AGAP001993 / 1281129 VectorBaseID:AGAP001993 Length:556 Species:Anopheles gambiae


Alignment Length:310 Identity:66/310 - (21%)
Similarity:125/310 - (40%) Gaps:56/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NPANYHQQQP--ALNHHTLAAAHHQQQL-------HHHAAAAGHLSHVGGGHAASNHLAAAAVLG 66
            :|....|.||  |.....|.|...|||:       ....|||...:......|...    |....
Mosquito    73 SPQQQQQPQPTAAQQQQQLQAQLQQQQVQAQVQQQQQQQAAAQQQAQQQQAQAQQQ----AQQQA 133

  Fly    67 RHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDS------GKIYIKNLERSID 125
            :.....:.......:..|.|.....||.|    |.|.|.|.|:|::      ||:::..|.....
Mosquito   134 QQQQQVVAQQQQQVNGASVNGCAKTGGNA----SNGSSSGRSTPNNGSDPAPGKLFVGGLSWQTS 194

  Fly   126 NKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDS----EEAARAAIEKVNGMLCNNQKVHV 185
            ::.:.:.|.:||.:.:..:.||. ...|||:||:.|..    ::..:..|..::|     :|:..
Mosquito   195 SEKLSEYFGMFGTVTDVLIMKDPVTQRSRGFGFITFQEPNSVDKVLQVPIHTLDG-----KKIDP 254

  Fly   186 VKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVA 249
            ....| ::|.:.::...|.::|..:|::.:.:.::..|..:|::....:::|:: .|.|.||||.
Mosquito   255 KHATP-KNRPKTQSNKTKKIFVGGVSQDTSAEEVKAYFSQFGKVEETVMLMDQQTKRHRGFGFVT 318

  Fly   250 YENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQ 299
            :|| :..:..|..:|...:.                    |:|:|.:|.|
Mosquito   319 FEN-EDVVDRVCEIHFHTIK--------------------NKKVECKKAQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/74 (20%)
RRM3_I_PABPs 202..282 CDD:240826 16/80 (20%)
AgaP_AGAP001993XP_321067.5 RRM <164..323 CDD:223796 38/165 (23%)
RRM1_hnRNPA_hnRNPD_like 184..255 CDD:240771 15/75 (20%)
RRM2_MSI 272..345 CDD:240769 18/93 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.