DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP010496

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_314469.4 Gene:AgaP_AGAP010496 / 1275237 VectorBaseID:AGAP010496 Length:258 Species:Anopheles gambiae


Alignment Length:217 Identity:46/217 - (21%)
Similarity:82/217 - (37%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRG--YGFVHFDSEEAARAAIEKVNGM 176
            :||:.||...|..|.:.|.|..||.:...::.     |.||  :.||.|:....|..|::..:|.
Mosquito     9 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLK-----NRRGPPFAFVEFEDARDADDAVKARDGY 68

  Fly   177 LCNNQKVHVVKFIPR--------------RDREQE-----------KATHFKNLYVKNLSEEFTE 216
            ..:..::.|.  .||              .||...           :.:.|: :.|..|....:.
Mosquito    69 DYDGYRLRVE--FPRGGGPGSYRGSRQGNSDRNSRGGDRNNRGPPARRSQFR-VMVTGLPSSGSW 130

  Fly   217 QHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALS 281
            |.|::.....|.:....:..|..|...   |:.:|:.:.|:        |:|.|::|        
Mosquito   131 QDLKDHMREAGDVCFADVYKDGTGVVE---FLRHEDMKYAI--------KKLDDSRF-------- 176

  Fly   282 KAERQQEINRKL---EERKRQK 300
               |..|:::|.   .||:|:|
Mosquito   177 ---RSHEVSKKTRGEREREREK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/71 (27%)
RRM3_I_PABPs 202..282 CDD:240826 15/79 (19%)
AgaP_AGAP010496XP_314469.4 RRM <1..183 CDD:223796 41/203 (20%)
RRM1_SRSF1 9..81 CDD:241041 20/78 (26%)
RRM2_SRSF1_like 117..180 CDD:241045 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.