DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP000399

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_003436985.1 Gene:AgaP_AGAP000399 / 1271847 VectorBaseID:AGAP000399 Length:371 Species:Anopheles gambiae


Alignment Length:274 Identity:59/274 - (21%)
Similarity:119/274 - (43%) Gaps:55/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGG 93
            :.:..||....||||          ||:...|.||....:|::...:.:.:|.:|:.....    
Mosquito    34 STNQPQQTEQQAAAA----------AAAAPAAPAAAASGNGNSEATNTNGNTENHTTATTT---- 84

  Fly    94 GALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGF 157
             ...:.:|..:......|..|:::..|.....:|.:.:.||.:|:|.:.||..|.: |.|||:.|
Mosquito    85 -TTTTTTTAAATATVRDDDRKLFVGGLSWETSDKELKEHFSQYGDIESINVKTDPNTGRSRGFAF 148

  Fly   158 VHFDSEEAARAAIEKVNGM---LCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHL 219
            :.:.|.:    :|:||..:   :.||:||         |.::.||.:.| ::|..|:.|.:::.:
Mosquito   149 IVYKSAD----SIDKVVAVSEHVINNKKV---------DPKKAKARYGK-IFVGGLTSEISDEEI 199

  Fly   220 REMFEPYGRITSHKLMLDEEGRSRR-FGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKA 283
            :..|..:|.|...::..|::...|: |.|:.:::.|                     |...|.|.
Mosquito   200 KTFFGQFGNIVEVEMPFDKQKNQRKGFCFITFDSEQ---------------------VVNELLKT 243

  Fly   284 ERQQEINRKLEERK 297
            .:|....::::.:|
Mosquito   244 PKQTISGKEVDVKK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/73 (30%)
RRM3_I_PABPs 202..282 CDD:240826 14/80 (18%)
AgaP_AGAP000399XP_003436985.1 RRM_SF 105..176 CDD:302621 23/83 (28%)
RRM2_hnRNPD_like 184..258 CDD:240775 17/96 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.