DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP011092

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_309558.3 Gene:AgaP_AGAP011092 / 1270836 VectorBaseID:AGAP011092 Length:634 Species:Anopheles gambiae


Alignment Length:191 Identity:109/191 - (57%)
Similarity:146/191 - (76%) Gaps:4/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||::.|||||:|||||.|||||:|.||:||.|.|:|||||||::||:|..:||||||||
Mosquito    90 GNVFIKNLDKKIDNKAMYDTFSAFGNILSCKVAQDEKGQSKGYGFVHFETEESANTSIEKVNGML 154

  Fly   178 CNNQKVHVVKFIPRRDREQ---EKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .|.:||:|.:||.|::||:   |||..|.|:||||..|:.||:.||:|||.:|.||||::| .::
Mosquito   155 LNEKKVYVGRFISRKEREKELGEKAKLFTNVYVKNFGEDLTEEALRDMFEKFGPITSHRVM-TKD 218

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            |:||.|||||:|.|:.|..||..|:||:|.|.|.|||.||..|.|||.|:.|:.|:.|.::
Mosquito   219 GKSRGFGFVAFEKPEDAEEAVQKLNGKELSDGKVLYVGRAQKKNERQMELKRRFEQLKMER 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 47/69 (68%)
RRM3_I_PABPs 202..282 CDD:240826 44/79 (56%)
AgaP_AGAP011092XP_309558.3 PABP-1234 2..624 CDD:130689 109/191 (57%)
RRM1_I_PABPs 3..82 CDD:240824
RRM2_I_PABPs 88..164 CDD:240825 49/73 (67%)
RRM3_I_PABPs 182..261 CDD:240826 44/79 (56%)
RRM4_I_PABPs 285..362 CDD:240827
PABP 556..623 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.