DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP003899

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_560351.3 Gene:AgaP_AGAP003899 / 1269490 VectorBaseID:AGAP003899 Length:302 Species:Anopheles gambiae


Alignment Length:302 Identity:87/302 - (28%)
Similarity:131/302 - (43%) Gaps:77/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NSMTF-RGNPANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGR 67
            :|.|| .|||:..|       ||     ||    |||    .|||     ..||:|         
Mosquito    49 SSSTFGGGNPSTPH-------HH-----HH----HHH----NHLS-----QPASHH--------- 79

  Fly    68 HGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDT 132
                     |||:||.|:..|:..|     .||:|.:|.|       :.:..|.:.:..:.:|..
Mosquito    80 ---------HTSSSSTSSLTGMNFG-----PGSSGTAGTN-------LIVNYLPQDMTEREMYSM 123

  Fly   133 FSVFGNILNCNVAKD--EDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDRE 195
            ||..|.|.:|.:.:|  :.|.|.|:|||::.:||||:.||:.:||....|:::.|....|:.|..
Mosquito   124 FSAMGPIESCRLMRDLKQTGYSYGFGFVNYLNEEAAQRAIKCLNGYPLRNKRLKVSYARPQSDDI 188

  Fly   196 QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAA 259
            :|     .|||:.||....||:.|..:|..||.|....::.|: .|:.|...||.:...:.|..|
Mosquito   189 KE-----TNLYITNLPRTITEEQLDIIFGKYGTIVQKNILRDKLTGQPRGVAFVRFNKREEAQEA 248

  Fly   260 VIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKA 301
            :..|:             ..:.:...|..|.|..|:..|.||
Mosquito   249 ISALN-------------NVIPQGGNQPLIVRVAEDHGRAKA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/71 (32%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)
AgaP_AGAP003899XP_560351.3 RRM_SF 104..185 CDD:302621 26/87 (30%)
RRM_SF 191..269 CDD:302621 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.