DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CELF3

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_009116.3 Gene:CELF3 / 11189 HGNCID:11967 Length:465 Species:Homo sapiens


Alignment Length:194 Identity:50/194 - (25%)
Similarity:94/194 - (48%) Gaps:16/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHF---DSEEAARAAI 170
            ||:.|:::..:.|.::.|.:...|..||.|....|.||: .|..:|..|:.:   ||...|::|:
Human     4 PDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSAL 68

  Fly   171 EKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLM 235
            .:...:...|:.:.|      :..:.|.....:.|:|..|.::.|::.:|:||||:|.|....::
Human    69 HEQKTLPGMNRPIQV------KPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVL 127

  Fly   236 LDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL--GDNKFLYVARALSKAE----RQQEINRKL 293
            ...:|.|:...||.::....|.||:..||..:.  |.:..|.|..|.::.|    |.|::..:|
Human   128 RGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/73 (23%)
RRM3_I_PABPs 202..282 CDD:240826 24/81 (30%)
CELF3NP_009116.3 RRM1_CELF3_4_5_6 2..88 CDD:410041 21/89 (24%)
RRM2_CELF3_4_5_6 94..174 CDD:410043 23/79 (29%)
PRK12323 <214..>351 CDD:237057
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..379
RRM3_CELF3_4_5_6 376..454 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.