powered by:
Protein Alignment CG4612 and AgaP_AGAP013420
DIOPT Version :9
Sequence 1: | NP_001246493.1 |
Gene: | CG4612 / 37914 |
FlyBaseID: | FBgn0035016 |
Length: | 307 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003436702.1 |
Gene: | AgaP_AGAP013420 / 11175609 |
VectorBaseID: | AGAP013420 |
Length: | 197 |
Species: | Anopheles gambiae |
Alignment Length: | 53 |
Identity: | 16/53 - (30%) |
Similarity: | 29/53 - (54%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 YVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGR-SRRFGFVAYENPQSAL 257
|:.||..:.|...::::|..:|:|....::.|:..| |:...||.:.|.|.||
Mosquito 16 YISNLPFDLTNIDVQKLFSKHGKIIKVTILRDKVSRKSKGVAFVLFSNAQEAL 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.