DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and HNRNPA0

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_006796.1 Gene:HNRNPA0 / 10949 HGNCID:5030 Length:305 Species:Homo sapiens


Alignment Length:159 Identity:45/159 - (28%)
Similarity:74/159 - (46%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNC-NVAKDEDGNSRGYGFVHFDSEEAARAAI----EKV 173
            |::|..|........:...|..||.:.:| .|...:...||.:|||.:.:.|.|.||:    ..|
Human     8 KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72

  Fly   174 NGMLCNNQKVHVVKFIPRRDREQEKA-THFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD 237
            :|     ..|.:.:.:.|.|..:..| ...|.|:|..|..:..|..|.|.|..:|.:...:::.|
Human    73 DG-----NTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIAD 132

  Fly   238 EE-GRSRRFGFVAYENPQSA-LAAVIGLH 264
            :: |:.|.||||.::|..:| .|||:..|
Human   133 KQSGKKRGFGFVYFQNHDAADKAAVVKFH 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/74 (26%)
RRM3_I_PABPs 202..282 CDD:240826 22/65 (34%)
HNRNPA0NP_006796.1 RRM1_hnRNPA0 5..83 CDD:240772 20/79 (25%)
RRM2_hnRNPA0 99..178 CDD:241023 21/63 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214
HnRNPA1 255..>269 CDD:314495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.