DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CELF2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_024303540.1 Gene:CELF2 / 10659 HGNCID:2550 Length:549 Species:Homo sapiens


Alignment Length:242 Identity:57/242 - (23%)
Similarity:109/242 - (45%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 HSANVGVGVGGGALASGSTGGSGG------NSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILN 141
            :|......:.|...::|:.....|      ...||:.|:::..:.||...|.:.:.|..:|.:..
Human    35 YSQETATELAGSLPSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQ 99

  Fly   142 CNVAKDEDGN---SRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIP---------RRDR 194
            .||.:|...|   |:|..||.|.:.   :||:|..|.:       |.:|.:|         ..|.
Human   100 INVLRDRSQNPPQSKGCCFVTFYTR---KAALEAQNAL-------HNIKTLPGMHHPIQMKPADS 154

  Fly   195 EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAA 259
            |:..|...:.|::..:|::..|..:|.||.|:|:|...:::...:|.||...||.:.....|..|
Human   155 EKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNA 219

  Fly   260 VIGLHGKQL--GDNKFLYVARALSKAERQQEINRKLEERKRQKAGQI 304
            :..:|..|.  |.:..:.|..|.::.:::|   |:|:::..|:..|:
Human   220 IKAMHQSQTMEGCSSPIVVKFADTQKDKEQ---RRLQQQLAQQMQQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/72 (25%)
RRM3_I_PABPs 202..282 CDD:240826 21/81 (26%)
CELF2XP_024303540.1 RRM1_CELF1_2_Bruno 70..153 CDD:241075 22/92 (24%)
RRM2_CELF1_2 162..242 CDD:241078 20/79 (25%)
RRM3_CELF1_2 457..548 CDD:241082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.