DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CELF1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001317201.1 Gene:CELF1 / 10658 HGNCID:2549 Length:514 Species:Homo sapiens


Alignment Length:272 Identity:71/272 - (26%)
Similarity:115/272 - (42%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QQPAL--NHHTLAAAH-----HQQQLHHHAAAAGHLSHV----GGGHAASNHLAAAAVLGRHGHN 71
            ||.|.  |.:||::.|     :..||.:.||.|...|..    .|.:|.:...:..:||    .:
Human   263 QQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVL----TS 323

  Fly    72 SLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVF 136
            |.||..:|:||:|.|....:|.....:|:|.|....|                           .
Human   324 SAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGS---------------------------L 361

  Fly   137 GNILNCNVAKDEDGNSRGYGF-------VHFDSEEAARAAIEKV-NGMLCNNQKVHVVKFIPRRD 193
            ..:...|......|.|.|.|.       .:...::.|.||:..: |..|...|.:...       
Human   362 AGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAA------- 419

  Fly   194 REQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSAL 257
            ..|::.....||::.:|.:||.:|.|.:||.|:|.:.|.|:.:|:: ..|:.||||:|:||.||.
Human   420 GSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQ 484

  Fly   258 AAVIGLHGKQLG 269
            ||:..::|.|:|
Human   485 AAIQSMNGFQIG 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 11/77 (14%)
RRM3_I_PABPs 202..282 CDD:240826 29/69 (42%)
CELF1NP_001317201.1 RRM1_CELF1_2_Bruno 42..125 CDD:410040
RRM2_CELF1_2 134..214 CDD:410042
RRM3_CELF1_2 422..513 CDD:241082 30/75 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.