| Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006363.4 | Gene: | SYNCRIP / 10492 | HGNCID: | 16918 | Length: | 623 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 44/202 - (21%) |
|---|---|---|---|
| Similarity: | 96/202 - (47%) | Gaps: | 15/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNV---AKDEDGNSRGYGFVHF-DSEEAARAAIEK 172
Fly 173 VNGMLCNNQKVHVVKFI-PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML 236
Fly 237 DEEGRSRRFGFVAYENPQSALAAVIGLHGKQL-GDNKFLYVARALSKAERQQEINRKLEERKRQK 300
Fly 301 AGQIFYY 307 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 14/73 (19%) |
| RRM3_I_PABPs | 202..282 | CDD:240826 | 21/80 (26%) | ||
| SYNCRIP | NP_006363.4 | NURR_hnRNPQ | 23..107 | CDD:410954 | |
| hnRNP-R-Q | 103..615 | CDD:273732 | 44/202 (22%) | ||
| Interaction with APOBEC1 | 400..561 | 7/37 (19%) | |||
| 8 X 3 AA repeats of R-G-G | 448..559 | ||||
| 3 X 4 AA repeats of Y-Y-G-Y | 460..488 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 497..623 | ||||
| Interaction with SMN. /evidence=ECO:0000269|PubMed:11574476 | 518..549 | ||||
| Bipartite nuclear localization signal. /evidence=ECO:0000255 | 564..578 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||