| Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001095868.1 | Gene: | HNRNPR / 10236 | HGNCID: | 5047 | Length: | 636 | Species: | Homo sapiens |
| Alignment Length: | 307 | Identity: | 54/307 - (17%) |
|---|---|---|---|
| Similarity: | 109/307 - (35%) | Gaps: | 120/307 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 GNSSPDS----------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVH 159
Fly 160 FDSEEAARAAIEKVNGMLCNNQKV----HV------------VKFIPRR---------------- 192
Fly 193 --------------DREQEKATHF----------------------------------------- 202
Fly 203 ------KNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVI 261
Fly 262 GLHGKQL-GDNKFLYVARALSKAERQQEINRKLEERKRQKAGQIFYY 307 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 17/74 (23%) |
| RRM3_I_PABPs | 202..282 | CDD:240826 | 22/127 (17%) | ||
| HNRNPR | NP_001095868.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
| NURR_hnRNPR | 27..110 | CDD:410955 | |||
| hnRNP-R-Q | 106..631 | CDD:273732 | 54/307 (18%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 415..459 | 6/28 (21%) | |||
| Nuclear localization signal. /evidence=ECO:0000255 | 415..421 | 1/5 (20%) | |||
| RNA-binding RGG-box | 450..570 | ||||
| 3 X 11 AA approximate repeats of D-D-Y-Y-G-Y-D-Y-H-D-Y | 465..500 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 504..636 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||