DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and celf5b

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_021322092.1 Gene:celf5b / 101884815 ZFINID:ZDB-GENE-070912-150 Length:334 Species:Danio rerio


Alignment Length:337 Identity:61/337 - (18%)
Similarity:104/337 - (30%) Gaps:160/337 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKV 173
            |.:..|:::..|.:....:.||..|..:|.|..|.|.:..||||:|..||.|.:...|::||..:
Zfish     2 SLEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHTEAQSAIGGL 66

  Fly   174 NG--MLCNNQKVHVVKF------------------------------------------------ 188
            :|  .:.......||||                                                
Zfish    67 HGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPSVALPFSTYSSTYSTYTHALMQQQ 131

  Fly   189 ----------------------------------------------------------------- 188
                                                                             
Zfish   132 AAIMAASHGGYLAPSVAFPATQIHQVGALNMNGLPPTPMTPVSGLSSPPANLASSAVPSIVTPIV 196

  Fly   189 -----IPRR-------------------------DREQEKATHFK--------NLYVKNLSEEFT 215
                 ||.:                         |..|:..|..:        ||::.:|.:||.
Zfish   197 NGFSGIPHQPNGHPVEAVYTNGLPPYSTQSPTAADTLQQAFTGVQQYTGPEGCNLFIYHLPQEFG 261

  Fly   216 EQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARA 279
            :..|.:||.|:|.:.|.|:.:|. ..:|:.||||:::||.||.||:..::|.|:|      :.|.
Zfish   262 DNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIG------MKRL 320

  Fly   280 LSKAERQQEINR 291
            ..:.:|.::.:|
Zfish   321 KVQLKRPKDASR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/71 (28%)
RRM3_I_PABPs 202..282 CDD:240826 28/88 (32%)
celf5bXP_021322092.1 RRM <2..330 CDD:330708 60/333 (18%)
RRM2_CELF3_4_5_6 5..85 CDD:241079 25/79 (32%)
RRM3_CELF3_4_5_6 245..323 CDD:241083 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.