Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021322092.1 | Gene: | celf5b / 101884815 | ZFINID: | ZDB-GENE-070912-150 | Length: | 334 | Species: | Danio rerio |
Alignment Length: | 337 | Identity: | 61/337 - (18%) |
---|---|---|---|
Similarity: | 104/337 - (30%) | Gaps: | 160/337 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 SPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKV 173
Fly 174 NG--MLCNNQKVHVVKF------------------------------------------------ 188
Fly 189 ----------------------------------------------------------------- 188
Fly 189 -----IPRR-------------------------DREQEKATHFK--------NLYVKNLSEEFT 215
Fly 216 EQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARA 279
Fly 280 LSKAERQQEINR 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 20/71 (28%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 28/88 (32%) | ||
celf5b | XP_021322092.1 | RRM | <2..330 | CDD:330708 | 60/333 (18%) |
RRM2_CELF3_4_5_6 | 5..85 | CDD:241079 | 25/79 (32%) | ||
RRM3_CELF3_4_5_6 | 245..323 | CDD:241083 | 28/83 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |