DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and a1cf

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_002935470.2 Gene:a1cf / 100493284 XenbaseID:XB-GENE-952965 Length:591 Species:Xenopus tropicalis


Alignment Length:222 Identity:50/222 - (22%)
Similarity:85/222 - (38%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSG- 113
            |.|.|.:...||...|.:.      :|::.|..:         |.....|...|..| ..|:.| 
 Frog     8 GEGMAGTQKEAALRALIQR------TGYSLTQEN---------GQRRYGGPPPGWDG-PPPERGC 56

  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            :|:|..|.|.:....:.......|.:....:..|.:||:|||.||.|.:.:.||.||:::|....
 Frog    57 EIFIGKLPRDLFEDELIPLCEKTGKVYEMRMMMDFNGNNRGYAFVTFTNRQDARDAIKQLNNYEI 121

  Fly   179 NNQKV-----------HVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSH 232
            .|.::           ..|..||:..|.:|.....:.:         |:..|..:..|...    
 Frog   122 RNGRLLGVCASVDNCRLFVGGIPKTKRREEILVEMRKV---------TDGVLDVIVYPSAA---- 173

  Fly   233 KLMLDEEGRSRRFGFVAYENPQSALAA 259
                 ::.::|.|.||.||:.::|..|
 Frog   174 -----DKSKNRGFAFVEYESHRAAAMA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/80 (25%)
RRM3_I_PABPs 202..282 CDD:240826 11/58 (19%)
a1cfXP_002935470.2 hnRNP-R-Q 2..591 CDD:273732 50/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.