DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and LOC100490872

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_002932728.2 Gene:LOC100490872 / 100490872 -ID:- Length:449 Species:Xenopus tropicalis


Alignment Length:200 Identity:65/200 - (32%)
Similarity:101/200 - (50%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNI-LNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            ||:||..:.||.    |.|  ||.. .:..:..::.|....:|.:.|:.::.|..|::|:.||..
 Frog    48 IYVKNFVKEIDE----DDF--FGKCGASTKIINNDCGQQTEFGLLPFNKQKDAIRAVDKMKGMDI 106

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFK--------------NLYVKNLSEEFTEQHLREMFEPYGRI 229
                     ::.:...::::.|.|.              ||||||||.|..:..|.:.|.|:|.|
 Frog   107 ---------YLAQAKIKEKRQTEFSKKPEPLHKPRYNSVNLYVKNLSYEIDDYRLNKEFAPFGII 162

  Fly   230 TSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQ----QEIN 290
            ||.|:| .|.|||:.||||.:..|..|..|:.|::||.|. :|.||||.|..|.|||    |:..
 Frog   163 TSAKVM-REGGRSKGFGFVCFSTPAEARKALSGMNGKILA-SKPLYVAWAQRKQERQVSLAQQYT 225

  Fly   291 RKLEE 295
            :::|:
 Frog   226 QRMEK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/70 (26%)
RRM3_I_PABPs 202..282 CDD:240826 40/93 (43%)
LOC100490872XP_002932728.2 PABP-1234 <7..431 CDD:130689 65/199 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D225999at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.