DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and celf3b

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_021322469.1 Gene:celf3b / 100333973 ZFINID:ZDB-GENE-110408-50 Length:442 Species:Danio rerio


Alignment Length:198 Identity:49/198 - (24%)
Similarity:95/198 - (47%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKV 173
            ||:.|::|..:.|:::.|.:...|..:|.|....|.||: .|..:|..|:.:.:.|:|..|    
Zfish     4 PDAIKLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAVKA---- 64

  Fly   174 NGMLCNNQKVHVVKFIPRRDR-------EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITS 231
                  ...:|..|.:|..:|       :.|.....:.|:|..|.::.:::.:|::|||:|.|..
Zfish    65 ------QSALHEQKTLPGMNRPIQVKPADSEGRGEDRKLFVGMLGKQQSDEDVRKIFEPFGGIDE 123

  Fly   232 HKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL--GDNKFLYVARALSKAE----RQQEIN 290
            ..::...:|.|:...||.:::...|.:|:..|||.:.  |.:..|.|..|.::.|    |.|::.
Zfish   124 CTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRTLPGASSSLVVKFADTEKERGVRRMQQVT 188

  Fly   291 RKL 293
            .:|
Zfish   189 SQL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/70 (21%)
RRM3_I_PABPs 202..282 CDD:240826 22/81 (27%)
celf3bXP_021322469.1 RRM1_CELF3_4_5_6 2..88 CDD:241076 22/93 (24%)
RRM2_CELF3_4_5_6 94..174 CDD:241079 21/79 (27%)
EBV-NA3 <226..417 CDD:332796
RRM3_CELF3_4_5_6 353..431 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.