Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021322469.1 | Gene: | celf3b / 100333973 | ZFINID: | ZDB-GENE-110408-50 | Length: | 442 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 49/198 - (24%) |
---|---|---|---|
Similarity: | 95/198 - (47%) | Gaps: | 24/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKV 173
Fly 174 NGMLCNNQKVHVVKFIPRRDR-------EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITS 231
Fly 232 HKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL--GDNKFLYVARALSKAE----RQQEIN 290
Fly 291 RKL 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 15/70 (21%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 22/81 (27%) | ||
celf3b | XP_021322469.1 | RRM1_CELF3_4_5_6 | 2..88 | CDD:241076 | 22/93 (24%) |
RRM2_CELF3_4_5_6 | 94..174 | CDD:241079 | 21/79 (27%) | ||
EBV-NA3 | <226..417 | CDD:332796 | |||
RRM3_CELF3_4_5_6 | 353..431 | CDD:241083 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |