DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and rbm47

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001135499.1 Gene:rbm47 / 100216039 XenbaseID:XB-GENE-976707 Length:412 Species:Xenopus tropicalis


Alignment Length:266 Identity:52/266 - (19%)
Similarity:98/266 - (36%) Gaps:85/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 STSSHSANVGVGVGG----GALAS-------------------GSTGGSGGNSSPDSGKIYIKNL 120
            |::..::|:..||.|    .||.:                   |...|..|:..|...::::..:
 Frog    14 SSNMSTSNIPEGVAGAPNEAALINLMERTGYTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKI 78

  Fly   121 ERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVN----------G 175
            .|.:....:...|...|.|....:..|.||.:|||.||.|..:..|:.|:.::|          |
 Frog    79 PRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLG 143

  Fly   176 MLCNNQKVHV-VKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD-- 237
            :.|:.....: :..||:..:.:                        |:.|...::|..  :||  
 Frog   144 VCCSVDNCRLFIGGIPKMKKRE------------------------EILEEISKVTEG--VLDVI 182

  Fly   238 ------EEGRSRRFGFVAYENPQSALAA-------VIGLHGKQLGDNKFLYVARALSKAERQQEI 289
                  ::.::|.|.||.||:.::|..|       .|.|.|.|:          |:..||.:.::
 Frog   183 VYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQI----------AVDWAEPEIDV 237

  Fly   290 NRKLEE 295
            :..:.|
 Frog   238 DEDVME 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/79 (23%)
RRM3_I_PABPs 202..282 CDD:240826 18/94 (19%)
rbm47NP_001135499.1 hnRNP-R-Q 13..>378 CDD:273732 52/266 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.