Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012815941.1 | Gene: | elavl4 / 100125165 | XenbaseID: | XB-GENE-948210 | Length: | 430 | Species: | Xenopus tropicalis |
Alignment Length: | 220 | Identity: | 53/220 - (24%) |
---|---|---|---|
Similarity: | 91/220 - (41%) | Gaps: | 48/220 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 VGGGALASGSTGGSG-----------GNSSPDSGKIYIKN-LERSIDNKAVYDTFSVFGNILNCN 143
Fly 144 VAKDE------------------------------DGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
Fly 179 NNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRS 242
Fly 243 RRFGFVAYENPQSALAAVIGLHGKQ 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 20/100 (20%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 23/67 (34%) | ||
elavl4 | XP_012815941.1 | ELAV_HUD_SF | 78..429 | CDD:273741 | 47/189 (25%) |
RRM1_Hu | 80..186 | CDD:241094 | 21/110 (19%) | ||
RRM_SF | 191..280 | CDD:302621 | 23/71 (32%) | ||
RRM3_HuD | 344..429 | CDD:241100 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |