DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and elavl4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_012815941.1 Gene:elavl4 / 100125165 XenbaseID:XB-GENE-948210 Length:430 Species:Xenopus tropicalis


Alignment Length:220 Identity:53/220 - (24%)
Similarity:91/220 - (41%) Gaps:48/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VGGGALASGSTGGSG-----------GNSSPDSGKIYIKN-LERSIDNKAVYDTFSVFGNILNCN 143
            |..|..::.|.|.|.           |.::.||....|.| |.:::..:.....|...|.|.:|.
 Frog    47 VSNGPTSNTSNGPSSNSRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCK 111

  Fly   144 VAKDE------------------------------DGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            :.:|:                              .|.|.|||||::...:.|..||..:||:..
 Frog   112 LVRDKITGTQFEEHFKDLATGTKWKPLTEEGPIFGKGQSLGYGFVNYIDPKDAEKAINTLNGLRL 176

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRS 242
            ..:.:.|     ...|....:....||||..|.:..|::.|.::|..||||.:.::::|: .|.|
 Frog   177 QTKTIKV-----SYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVS 236

  Fly   243 RRFGFVAYENPQSALAAVIGLHGKQ 267
            |..||:.::....|..|:.||:|::
 Frog   237 RGVGFIRFDKRIEAEEAIKGLNGQK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/100 (20%)
RRM3_I_PABPs 202..282 CDD:240826 23/67 (34%)
elavl4XP_012815941.1 ELAV_HUD_SF 78..429 CDD:273741 47/189 (25%)
RRM1_Hu 80..186 CDD:241094 21/110 (19%)
RRM_SF 191..280 CDD:302621 23/71 (32%)
RRM3_HuD 344..429 CDD:241100
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.