DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and msi2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_004911774.1 Gene:msi2 / 100038158 XenbaseID:XB-GENE-488852 Length:407 Species:Xenopus tropicalis


Alignment Length:217 Identity:60/217 - (27%)
Similarity:97/217 - (44%) Gaps:34/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ASGS--TGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFV 158
            |.||  |.||..:|..|.||::|..|.......::.|.|:.||.|..|.|.:| ....|||:|||
 Frog     3 ADGSQATSGSPNDSQHDPGKMFIGGLSWQTSPDSLRDYFNKFGEIRECMVMRDPTTKRSRGFGFV 67

  Fly   159 HFDSEEAARAAIEKVNGM---LCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLR 220
            .|    |..|:::||...   ..:::.:......||| .:.:..|..|.::|..||.....:.::
 Frog    68 TF----ADPASVDKVLAQPHHELDSKTIDPKVAFPRR-AQPKMVTRTKKIFVGGLSANTVVEDVK 127

  Fly   221 EMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAE 284
            :.||.:|::....||.|: ..|.|.||||.:| .:..:..|..:|                    
 Frog   128 QYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFE-IEDVVEKVCEIH-------------------- 171

  Fly   285 RQQEINRKLEERKRQKAGQIFY 306
             ..|||.|:.|.|:.:..::.:
 Frog   172 -FHEINNKMVECKKAQPKEVMF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/73 (29%)
RRM3_I_PABPs 202..282 CDD:240826 19/80 (24%)
msi2XP_004911774.1 RRM <2..162 CDD:223796 52/164 (32%)
RRM1_MSI 23..97 CDD:241020 21/77 (27%)
RRM2_MSI 111..184 CDD:240769 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.