Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001090639.1 | Gene: | celf5 / 100036604 | XenbaseID: | XB-GENE-494002 | Length: | 486 | Species: | Xenopus tropicalis |
Alignment Length: | 349 | Identity: | 59/349 - (16%) |
---|---|---|---|
Similarity: | 96/349 - (27%) | Gaps: | 185/349 - (53%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 SGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDS 162
Fly 163 EEAARAAIEKVNGM--------------------------------------------------- 176
Fly 177 --------------------------LCNNQKVHVVKF--------------------------- 188
Fly 189 ------------------IPRRDR----------------------------------------- 194
Fly 195 -------------EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRF 245
Fly 246 GFVAYENPQSALAAVIGLHGKQLG 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 23/146 (16%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 27/69 (39%) | ||
celf5 | NP_001090639.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
RRM1_CELF3_4_5_6 | 42..128 | CDD:241076 | 59/349 (17%) | ||
PABP-1234 | <49..374 | CDD:130689 | 31/253 (12%) | ||
RRM2_CELF3_4_5_6 | 134..214 | CDD:241079 | 22/79 (28%) | ||
RRM3_CELF3_4_5_6 | 397..475 | CDD:241083 | 27/72 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |