DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and celf5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001090639.1 Gene:celf5 / 100036604 XenbaseID:XB-GENE-494002 Length:486 Species:Xenopus tropicalis


Alignment Length:349 Identity:59/349 - (16%)
Similarity:96/349 - (27%) Gaps:185/349 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDS 162
            |.|.||        ..|:::..|.:....:.|...|..||:|..|:|.:..||:|:|..||.|.|
 Frog   128 SESRGG--------DRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSS 184

  Fly   163 EEAARAAIEKVNGM--------------------------------------------------- 176
            ...|:|||:.::|.                                                   
 Frog   185 HAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYA 249

  Fly   177 --------------------------LCNNQKVHVVKF--------------------------- 188
                                      .|:.|::..|..                           
 Frog   250 QALMQQQTTVLSTSHGSYLSPSVAFPSCHIQQIGAVNLNGLPAAPITPASGLHSPPVIGTAAVPG 314

  Fly   189 ------------------IPRRDR----------------------------------------- 194
                              .|..|.                                         
 Frog   315 LVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVESLHPSFTGVQQYSAIYPTAALT 379

  Fly   195 -------------EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRF 245
                         :|.:.....||::.:|.:||.:..|.:||.|:|.|.|.|:.:|. ..:|:.|
 Frog   380 PVTHSTPQPPPILQQREGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCF 444

  Fly   246 GFVAYENPQSALAAVIGLHGKQLG 269
            |||:::||.||..|:..::|.|:|
 Frog   445 GFVSFDNPSSAQTAIQAMNGFQIG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/146 (16%)
RRM3_I_PABPs 202..282 CDD:240826 27/69 (39%)
celf5NP_001090639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
RRM1_CELF3_4_5_6 42..128 CDD:241076 59/349 (17%)
PABP-1234 <49..374 CDD:130689 31/253 (12%)
RRM2_CELF3_4_5_6 134..214 CDD:241079 22/79 (28%)
RRM3_CELF3_4_5_6 397..475 CDD:241083 27/72 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.