DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psmb1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:175 Identity:43/175 - (24%)
Similarity:71/175 - (40%) Gaps:16/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRAVTIYSPDGHL--LQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKR-SVGDLQEERMVRKICML 67
            ||.: :..|.|..  :|:.::..|. .|.||:.:...:..::..:.| |.|.....|...|...|
  Rat    11 DREL-VMGPQGSAGPVQMRFSPYAF-NGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKL 73

  Fly    68 DDHVVMTFSGLTADARIL--VSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFG 130
            .|..|:..||...|...|  :..|:::...|..|  |..|    |..||.:......|....|:.
  Rat    74 TDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN--KAMT----TGAIAAMLSTILYSRRFFPYY 132

  Fly   131 LSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSS---QPVRD 172
            :..::.|.||:|...::..||.|.:........|.:|   ||:.|
  Rat   133 VYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 43/175 (25%)
Ntn_hydrolase 5..214 CDD:294319 43/175 (25%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.