DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PUP3

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:30/148 - (20%)
Similarity:57/148 - (38%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            ||.:..:||..|...|....:.:...::|..|:....|..|:.::  ...|.:..|  |:.:..:
Yeast    48 HVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVS--SSLYERRFG--PYFVGPV 108

  Fly   135 VGGFD-EDGTPHLFQTDPSGIFYEWR-ANTTGRSSQPV--------------RDYMEKHADEILT 183
            |.|.: :.|.|.:...|..|...|.: ...:|.:|..:              .|..|..:..:|.
Yeast   109 VAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLN 173

  Fly   184 IADEAA-----AIKHIVR 196
            .||..|     |:.:|::
Yeast   174 AADRDALSGWGAVVYIIK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 30/148 (20%)
Ntn_hydrolase 5..214 CDD:294319 30/148 (20%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 30/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.