DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PRE10

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_015007.1 Gene:PRE10 / 854544 SGDID:S000005889 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:66/202 - (32%)
Similarity:107/202 - (52%) Gaps:5/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            ||.:.:::||||...|||||.:||..|:|.:|::.|:.:|..|||.....|...:...||.::|.
Yeast     8 YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDR 72

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCL 134
            |:...:|||..|.|.||:|.:.||.|.:..::.|..:......:.|..|.:|..|..||||:|.:
Yeast    73 HIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTI 137

  Fly   135 VGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTLV 199
            .||.|::|. ||:..:|||.::.::...||:..|..:..:||..|.    ..|..:.:..|:...
Yeast   138 FGGVDKNGA-HLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDH----HPEGLSAREAVKQAA 197

  Fly   200 SVSSLNH 206
            .:..|.|
Yeast   198 KIIYLAH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 66/202 (33%)
Ntn_hydrolase 5..214 CDD:294319 66/202 (33%)
PRE10NP_015007.1 proteasome_alpha_type_3 5..219 CDD:239720 66/202 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.