DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PUP1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:48/209 - (22%)
Similarity:84/209 - (40%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YSPDGHLLQVEYAQ-EAVRRGSTVMGLRTNNAIVIGVEKRSV-GDLQEERMVRKICMLDDHVVMT 74
            |..:..|.:..:.| :|...|:|::|::.||.:||..:.||. |.:..::...|:..:...:...
Yeast     9 YQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCA 73

  Fly    75 FSGLTADARILVSRAQMEAQSHRL-NFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGF 138
            .:|..||...:........:.|.| ...:|..|.    .:..|||:..:..|.  .|...:|.|.
Yeast    74 GAGTAADTEAVTQLIGSNIELHSLYTSREPRVVS----ALQMLKQHLFKYQGH--IGAYLIVAGV 132

  Fly   139 DEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKH------ADEILTIADEAAAIKHIVRT 197
            |..|: |||.....|........:.|..|......:|.|      .:|.:.:|.:|.. ..|...
Yeast   133 DPTGS-HLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ-AGIWND 195

  Fly   198 LVSVSSLNHTQMEV 211
            |.|.|:::...||:
Yeast   196 LGSGSNVDVCVMEI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 48/209 (23%)
Ntn_hydrolase 5..214 CDD:294319 48/209 (23%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 43/188 (23%)
Pr_beta_C 223..257 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.