DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PUP2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_011769.1 Gene:PUP2 / 853168 SGDID:S000003485 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:77/251 - (30%)
Similarity:135/251 - (53%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            |||.|:.:||:|.|.||||:.||::.|||.:|:.|...:|:|||||:...|.|...:.||..:|.
Yeast     8 YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDR 72

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQ-SNGR-----RP 128
            |:....||||||||.::..|:..|.:|.|.:::...||.:|:.:..|...:.: ::|.     ||
Yeast    73 HIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRP 137

  Fly   129 FGLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKH 193
            ||::.|:.|.|.|....||..:|||.||.:.|...|..|:..:..:.......||:.:....:..
Yeast   138 FGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLK 202

  Fly   194 IVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVRREIEDEAEASRRP 249
            |::.::. ..|:....:::.:..:...::.|::..|:|.:.::     |.||:..|
Yeast   203 ILKQVME-EKLDENNAQLSCITKQDGFKIYDNEKTAELIKELK-----EKEAAESP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 70/215 (33%)
Ntn_hydrolase 5..214 CDD:294319 70/214 (33%)
PUP2NP_011769.1 proteasome_alpha_type_5 8..222 CDD:239722 70/214 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.