DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and AT1G79210

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001077845.1 Gene:AT1G79210 / 844262 AraportID:AT1G79210 Length:235 Species:Arabidopsis thaliana


Alignment Length:240 Identity:79/240 - (32%)
Similarity:135/240 - (56%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            :|..::|.:||.|.|:|:|:|..||..|.|.:|::.:|.:||..||:....|.:|..|:||..|.
plant     5 QYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHLT 69

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            .::...:||:..|.|:||.:::.:|:.:...:::|..|..:.|..|.:.|.:|||.|.||||:|.
plant    70 PNIGTVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVSL 134

  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTL 198
            ||.|:|:.| |.|:|.||||.::.|:|:..|::....:.::||...|.:.:.|   ||...:.||
plant   135 LVAGYDDKG-PQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDD---AIHTAILTL 195

  Fly   199 V-----SVSSLNHTQMEVA------VLKYRQPLRMIDHQVLADLE 232
            .     .:||.|   :|:.      |.:...|..:.|:  ||::|
plant   196 KEGFEGEISSKN---IEIGKIGTDKVFRVLTPAEIDDY--LAEVE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 74/220 (34%)
Ntn_hydrolase 5..214 CDD:294319 73/219 (33%)
AT1G79210NP_001077845.1 proteasome_alpha_type_2 6..232 CDD:239719 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.