DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PAF1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_199093.1 Gene:PAF1 / 834290 AraportID:AT5G42790 Length:278 Species:Arabidopsis thaliana


Alignment Length:252 Identity:88/252 - (34%)
Similarity:134/252 - (53%) Gaps:18/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            :||..||.:||.|.|.|||||.|||::||..:|||:.:.:|:....::..:|...:  |||..:|
plant     5 QYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ--RKIFKVD 67

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            ||:.:..:|||||.|:|....:.|:.:|...:|.|..|..:..::|...|..||.:.:||:|:..
plant    68 DHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVGL 132

  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHAD-------EILTIADEAAAI 191
            ||||.||.|. ||:...|||.::|::|...|..||..:.|:|:..:       |.| |.|...|:
plant   133 LVGGLDESGA-HLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESFGDSSREDL-IKDAILAV 195

  Fly   192 KHIVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDH---QVLADLERTVRREIEDEAEA 245
            :..::.....|||    ..||:|...:|...:|.   |.:.|....|..|.|.|.||
plant   196 RETLQGETLKSSL----CTVAILGVDEPFHFLDQEAIQKVIDTFEKVPEEEEGEGEA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 77/216 (36%)
Ntn_hydrolase 5..214 CDD:294319 77/215 (36%)
PAF1NP_199093.1 proteasome_alpha_type_1 6..215 CDD:239718 77/216 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.