DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PAD1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:253 Identity:121/253 - (47%)
Similarity:164/253 - (64%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            |||||:|::||||||.|||||.||||:|:..:|:|..:.:|:.|||:|...||:.|..|||..||
plant     3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLD 67

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            :|:.:..:||.||||:|:::|::|.|||||..|.|.||||||||||.|:|.||||.|.||||||.
plant    68 NHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLST 132

  Fly   134 LVGGFDE-DGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRT 197
            |:.|||. ...|.|:||||||.|..|:||.|||:|..:|:::||:..|  :...|  .:|..:|.
plant   133 LIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE--SAGQE--TVKLAIRA 193

  Fly   198 LVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLER----TVRREIEDE---AEASRR 248
            |:.|.......:||||:..       :..||..||.    .:..|||.|   |||:::
plant   194 LLEVVESGGKNIEVAVMTR-------EEGVLKQLEEEEIDIIVAEIEAEKAAAEAAKK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 109/210 (52%)
Ntn_hydrolase 5..214 CDD:294319 108/209 (52%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 108/209 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 220 1.000 Domainoid score I721
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 270 1.000 Inparanoid score I920
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm1115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.