DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PAC1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana


Alignment Length:230 Identity:77/230 - (33%)
Similarity:134/230 - (58%) Gaps:6/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIV-IGVEKRSVGDLQEERMVRKI 64
            |::|||...||:||:|.|.|||||.||:....:.:|:.:.:.:| ||.:|.:...||......|:
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKM 65

  Fly    65 CMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPF 129
            ..:||||....:|:.:||.||::.|:::||.:...:::|..||.:.:.:...||.|||..|.|||
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPF 130

  Fly   130 GLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAA--AIK 192
            |:|.|..|:|:.....|:.:||||.:..|:|...|.::|..:..:::...:..| .:||.  |:|
plant   131 GVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKDDAT-REEAVELALK 194

  Fly   193 HIVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQV 227
            .:.:|:.| :||...::|:|.: |..|.:.:.:.|
plant   195 VLTKTMDS-TSLTSEKLELAEV-YLTPSKTVKYHV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 72/212 (34%)
Ntn_hydrolase 5..214 CDD:294319 72/211 (34%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 73/213 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.