DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PAE2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_188046.1 Gene:PAE2 / 820649 AraportID:AT3G14290 Length:237 Species:Arabidopsis thaliana


Alignment Length:219 Identity:81/219 - (36%)
Similarity:128/219 - (58%) Gaps:8/219 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69
            |||.|..:||:|.|.|||||.||::.|||.:|::|...:|:.||||....|.|...|.||..:||
plant     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDD 72

  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNY---TQSNGRRPFGL 131
            |:....|||.||||.||..|::|.|:||.::.:|.|||..|:.:..|...:   .:.:..||||:
plant    73 HIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEEESMSRPFGV 137

  Fly   132 SCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIAD-EAAAI---K 192
            |.|:.|.||:| |.|:.|||||.|::..|...|..|:.....:::..::.:|:.: |..|:   |
plant   138 SLLIAGHDENG-PSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQEQFNKDITLQEAETIAVSILK 201

  Fly   193 HIVRTLVSVSSLNHTQMEVAVLKY 216
            .::...|:.::::..::..|...|
plant   202 QVMEEKVTPNNVDIAKVAPAYHLY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 80/216 (37%)
Ntn_hydrolase 5..214 CDD:294319 80/215 (37%)
PAE2NP_188046.1 proteasome_alpha_type_5 8..218 CDD:239722 79/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.