DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PSMB10

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:172 Identity:40/172 - (23%)
Similarity:73/172 - (42%) Gaps:12/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGD-LQEERMVRKICMLDDHVVMTFSGLTADA 82
            |:|.:|:   :.|:|:.||...:.:::|.:.|:..| :..::...||..:...:....:|:.|||
Human    30 LKVPHAR---KTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADA 91

  Fly    83 RILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFDEDGTPHLF 147
            .:.......:.:.|.|:..:...|..:||.:.|....|     :...|.|.:|||.|..| |.|:
Human    92 EMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRY-----QGHVGASLIVGGVDLTG-PQLY 150

  Fly   148 QTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAA 189
            ...|.|.:........|.........:|......:|:  |||
Human   151 GVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTL--EAA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 40/172 (23%)
Ntn_hydrolase 5..214 CDD:294319 40/172 (23%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 36/159 (23%)
Pr_beta_C 232..267 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.