DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and PSMB8

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:149 Identity:33/149 - (22%)
Similarity:64/149 - (42%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKR-SVGDLQEERMVRKICMLDDHVVMTFSGLTADA 82
            :|:|.|     .|:|.:..:..:.::..|:.| |.|.......|.|:..::.:::.|.||..||.
Human    65 VQIEMA-----HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADC 124

  Fly    83 RILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLS--CLVGGFDEDGTPH 145
            :........|.:.:.|...:..:|...::.::.:...|      |..|||  .::.|:|:.| |.
Human   125 QYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQY------RGMGLSMGSMICGWDKKG-PG 182

  Fly   146 LFQTDPSGIFYEWRANTTG 164
            |:..|..|........:||
Human   183 LYYVDEHGTRLSGNMFSTG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 33/149 (22%)
Ntn_hydrolase 5..214 CDD:294319 33/149 (22%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.