DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and psma4

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001007998.1 Gene:psma4 / 493360 XenbaseID:XB-GENE-5837209 Length:261 Species:Xenopus tropicalis


Alignment Length:259 Identity:84/259 - (32%)
Similarity:146/259 - (56%) Gaps:16/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMV-RKI 64
            |::|||...||:||:|.|.|||||.||:....|.:|:..|:.:::..|:|::..|.:|... .||
 Frog     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKI 65

  Fly    65 CMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPF 129
            ..|:|.:..:.:|:|:||.:|.:..::.||.:.|.:::|...|.:...:..:||.|||..|:|||
 Frog    66 YKLNDDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF 130

  Fly   130 GLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPV-----RDYMEKHADEILTIADEAA 189
            |:|.|..|:|:.....|:|:||||.:..|:|...|.:|...     :||  |..|..|..| .|.
 Frog   131 GVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDY--KEGDMTLKSA-LAL 192

  Fly   190 AIKHIVRTLVSVSSLNHTQMEVAVL---KYRQPLRMIDHQVLADLERTVRREIEDEAEASRRPR 250
            |:|.:.:|: .||.|:..::|:|.|   ..:..:|::..:   ::|..::...|:||:..|..:
 Frog   193 AVKVLNKTM-DVSKLSAEKVEIATLTRENGKTKIRVLKQK---EVEELIKLHEEEEAKIEREKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 76/218 (35%)
Ntn_hydrolase 5..214 CDD:294319 75/214 (35%)
psma4NP_001007998.1 proteasome_alpha_type_4 3..216 CDD:239721 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.