DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and psmb1

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:176 Identity:44/176 - (25%)
Similarity:69/176 - (39%) Gaps:23/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YSPDGHLLQVEYAQEAVRR-------GSTVMGLRTNN-AIVIGVEKRSVGDLQEERMVRKICMLD 68
            |..:|.:.:..|......:       |.||:.:...: |||....:.|.|.....|...|...|.
Zfish     7 YGENGKMKEYHYTGPVEHKFSPYAFNGGTVLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLT 71

  Fly    69 DHVVMTFSGLTADARIL--VSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRR--PF 129
            |..|:..||...|...|  :..|:::...|..|  |..|...|...::      |...|||  |:
Zfish    72 DTTVLGCSGFHGDCLTLTKIIEARLKMYKHSNN--KSMTSGAIAAMLS------TILYGRRFFPY 128

  Fly   130 GLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSS---QPVRD 172
            .:..::||.||:|...::..||.|.:........|.:|   ||:.|
Zfish   129 YVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 44/176 (25%)
Ntn_hydrolase 5..214 CDD:294319 44/176 (25%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 41/161 (25%)
proteasome_beta_type_1 26..237 CDD:239726 41/157 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.