DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and psmb10

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:217 Identity:52/217 - (23%)
Similarity:88/217 - (40%) Gaps:29/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDL-QEERMVRKICMLDDHVVMTFSGLTADARILVS 87
            |..|.:.|:|:.||...:.:::|.:.|:..|: ..::...||..:..::....:|:.|||.:...
Zfish    35 APNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAGVAADAEVTTQ 99

  Fly    88 RAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPS 152
            ......:.|.|:..:|..|..:||   ||||...:..|.  .|.|.:|||.|.:|. .|:...|.
Zfish   100 MMSSNVELHSLSTGRPPLVAMVTR---QLKQMLFRYQGH--IGSSLIVGGVDVNGA-QLYSVYPH 158

  Fly   153 GIFYEWRANTTGRSSQPVRDYMEKHADEILTIAD------EAAAIKHIVRTLVS------VSSLN 205
            |.:.:....|.|..:          |..|....|      |....|.:||..::      :.|.:
Zfish   159 GSYDKLPFLTMGSGA----------ASAISVFEDRYKPNMELEEAKQLVRDAITAGIFCDLGSGS 213

  Fly   206 HTQMEVAVLKYRQPLRMIDHQV 227
            :..:.|...|....||..|..|
Zfish   214 NVDLCVITDKKVDYLRTYDQPV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 47/203 (23%)
Ntn_hydrolase 5..214 CDD:294319 47/202 (23%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 45/199 (23%)
proteasome_beta_type_7 43..231 CDD:239732 47/203 (23%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.