DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta3

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster


Alignment Length:117 Identity:19/117 - (16%)
Similarity:46/117 - (39%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTVMGLRTNNAIVIGVEKRSVGDLQEERM---VRKICMLDDHVVMTFSGLTADA-----RILVS 87
            |..|:.:|..:.:.|..:.|.  .:|.:.:   .:|:..:...:.:..:||..|.     |::..
  Fly     8 GGCVVAMRGKDCVAIATDHRF--GIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFR 70

  Fly    88 RAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFD 139
            :...|.:.:|....||         .:.:..::...:...|:.:..:|.|.|
  Fly    71 KNLYETRENREMCPKP---------FSAMMSSFLYEHRFGPYFIEPVVAGLD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 19/117 (16%)
Ntn_hydrolase 5..214 CDD:294319 19/117 (16%)
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 19/117 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.