DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:164 Identity:47/164 - (28%)
Similarity:74/164 - (45%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRAVTIYSPDG----HLLQVEYAQE-------AVRRGSTVMGLRTNNAIVIGVEKRSV-GDLQEE 58
            ||:..:..|.|    :.|:.:..:|       :...|:||:|:..:..::||.|.|:. |.:...
  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77

  Fly    59 RMVRKICMLDDHVVMTFSGLTADARILV--SRAQMEAQSHRLN--FEKPTTVEYITRYIAQLKQN 119
            :..|||..|..::....:|...|.:.||  :|||:|.  ||:|  |.| ..|....:.|.||...
  Fly    78 KTCRKIIELQANIFAAGAGTARDTKALVELTRAQLEL--HRMNTGFRK-VPVCCANQMIRQLLFR 139

  Fly   120 YTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPSG 153
            :   ||.  .....::||.|..|. |||.|...|
  Fly   140 F---NGN--IDADMIIGGADNTGA-HLFCTRSDG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 47/164 (29%)
Ntn_hydrolase 5..214 CDD:294319 47/164 (29%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 47/164 (29%)
proteasome_beta_type_7 50..239 CDD:239732 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.