DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and psma2b

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001122146.1 Gene:psma2b / 403015 ZFINID:ZDB-GENE-060503-941 Length:234 Species:Danio rerio


Alignment Length:199 Identity:76/199 - (38%)
Similarity:123/199 - (61%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQR-YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKI 64
            ||:| |..::|.:||.|.|:|:|||..||..|:..:|::.:|.:|:..||:....|.:|:.|.|:
Zfish     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKV 65

  Fly    65 CMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPF 129
            ..:..|:.|.:||:..|.|:||.||:..||.:.|.:::|.....:.:.:|.:.|.||||.|.|||
Zfish    66 EPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPF 130

  Fly   130 GLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHI 194
            |:|.|:.|:||| .|:|||:||||.::.|:|...|::....:.::||..:|.|.:.|   ||...
Zfish   131 GVSLLIAGWDED-RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELED---AIHTA 191

  Fly   195 VRTL 198
            :.||
Zfish   192 ILTL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 73/194 (38%)
Ntn_hydrolase 5..214 CDD:294319 73/194 (38%)
psma2bNP_001122146.1 proteasome_alpha_type_2 6..231 CDD:239719 73/194 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.