DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:242 Identity:42/242 - (17%)
Similarity:93/242 - (38%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RRGSTVMGLRTNNAIVIGVEKRSV-GDLQEERMVRKICMLDDHVVMTFSGLTADARILVSRAQME 92
            :.|:|::|:...:.:::|.:.|:. |.:..::...||..|..::....:|..||..:.......:
  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101

  Fly    93 AQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPSGIFYE 157
            .:.|||..::...|......:.|:...|     :.....:.::||.|:.| ||::...|.|...:
  Fly   102 LELHRLQTDREVRVVAANTMLKQMLFRY-----QGHISAALVLGGVDKTG-PHIYSIHPHGSSDK 160

  Fly   158 WRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTLVSVSSLNH----TQMEVAVLK--- 215
            ....|.|..|.......|.....  .:::|..  |.:||..::....|.    :.:::.|::   
  Fly   161 LPYATMGSGSLAAMTVFESRWKP--DLSEEEG--KKLVRDAIASGVFNDLGSGSNIDLCVIRKGS 221

  Fly   216 ----------YRQPLRMIDHQVLADLERTVRREIEDEAEASRRPRAP 252
                      .::..|.:|::........:...|:|.....|....|
  Fly   222 VEYLRNYELANKKGKRQLDYRFKTGTSTVLHTNIKDLLVTERVQAVP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 36/190 (19%)
Ntn_hydrolase 5..214 CDD:294319 35/189 (19%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 34/199 (17%)
proteasome_beta_type_7 42..228 CDD:239732 34/195 (17%)
Pr_beta_C 232..264 CDD:289249 4/31 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.