DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosalpha3

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:264 Identity:83/264 - (31%)
Similarity:148/264 - (56%) Gaps:21/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERM-VRKI 64
            ||:|||...||:||:|.|.|||||.||:....|.:|:...:.|::..|.||...|.:..: ..||
  Fly     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKI 65

  Fly    65 CMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPF 129
            ..|:|::|.:.:|:|:||.:|.|..::.||.::.::.:....|.:..::..:||.|||..|:|||
  Fly    66 YRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPF 130

  Fly   130 GLSCLVGGFDEDGTPHLFQTDPSGIFYEWRA----NTTGRSSQPVRDYMEKHADEILTIAD-EAA 189
            |:|.|..|:|......|:|:||||.:..|:|    |..|.:...::..:....:..||:|| :..
  Fly   131 GVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDL 195

  Fly   190 AIKHIVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVL------ADLERTVRR--EIEDEAEAS 246
            |||.:..|| ..:.|...::|:|.      |:.:|::.:      .|:|:.:.:  :::.||||:
  Fly   196 AIKVLSMTL-DTTKLTPEKVEMAT------LQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAA 253

  Fly   247 RRPR 250
            ::.:
  Fly   254 KKEK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 72/215 (33%)
Ntn_hydrolase 5..214 CDD:294319 72/214 (34%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 79/250 (32%)
proteasome_alpha_type_4 3..219 CDD:239721 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.