DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Psma8

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:252 Identity:139/252 - (55%)
Similarity:191/252 - (75%) Gaps:4/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKIC 65
            ||.|||||:|::||||||.|||||||||::|||.:|:|..|.:|:||||:||..||:||.|||||
  Rat     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKIC 65

  Fly    66 MLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFG 130
            .|||||.|.|:|||||||:::|||::|.|||:|..|.|.|||||||:||.|||.|||||||||||
  Rat    66 ALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFG 130

  Fly   131 LSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIV 195
            :|.|:.|||:||.|.|:||||||.::.|:||..|||::.||:::||:..|. .|:::..|||..:
  Rat   131 ISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTED-AISNDNEAIKLAI 194

  Fly   196 RTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERT-VRREIEDEAEASRRPRA 251
            :.|:.|.......:|:|:::..|||:|...:.: :||.| :.|| :||||..:..::
  Rat   195 KALLEVVQSGGKNIELAIIRRDQPLKMFSAKEI-ELEVTEIERE-KDEAEKKKSKKS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 123/209 (59%)
Ntn_hydrolase 5..214 CDD:294319 123/208 (59%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 130/230 (57%)
proteasome_alpha_type_7 5..213 CDD:239724 123/208 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11582
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.