DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:228 Identity:41/228 - (17%)
Similarity:85/228 - (37%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TVMGLRTNNAIVIGVE---KRSVGDLQEERMVRKICMLDDHVVMTFSGLTADARILVSRAQMEAQ 94
            |::|::..:.:::..:   .||:..::|::  .||..:.|.::::..|.:.|.            
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQ--NKIHKVSDSLLISTVGESGDT------------ 53

  Fly    95 SHRLNFEKPTTVEYITRYIAQLKQ------------NYTQSN------GRRPFGLSCLVGGFDED 141
                  |:.|  |:|::.||..|.            ::|:.|      .|.|:.:...|.|:|.:
  Fly    54 ------EQFT--EFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPN 110

  Fly   142 GTPHLFQTDPSGIFYEWRANTT-------GRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTLV 199
            ..|.|       .|.::.||..       |..:.......:::....:|.|:.....|..:..:.
  Fly   111 AGPEL-------TFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQ 168

  Fly   200 SVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLE 232
            ....:|.....|||         :|...:.|||
  Fly   169 KRLVVNLKNFTVAV---------VDKDGVRDLE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 37/209 (18%)
Ntn_hydrolase 5..214 CDD:294319 36/208 (17%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 41/228 (18%)
proteasome_beta_type_2 1..192 CDD:239727 39/226 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.