DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosalpha6T

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster


Alignment Length:256 Identity:77/256 - (30%)
Similarity:128/256 - (50%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            :||...|.:||.|.|.|||||.|||::|:..:||:..:..|:....|:..|  ...:.|||..:|
  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKD--TNTLQRKIMPVD 67

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            |||.|:.:|||||||::....:.|..::|.::.....|..:...:....|..||...|||:|:..
  Fly    68 DHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGL 132

  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKH--------ADEILTIADEAAA 190
            ||.|:||.| ||::|..|:......:|...|..||..|.|:|::        .||::..|.:|  
  Fly   133 LVAGYDEQG-PHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQA-- 194

  Fly   191 IKHIVRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVR--REIEDEAEASRRP 249
                :|..:....:.:..:.||::....|.:|...   |:.::.|:  :.::...||...|
  Fly   195 ----IRGSLGSDDVENLTINVAIVGKDVPFKMFTE---AENQKYVKLVKAMDPPLEADHDP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 70/217 (32%)
Ntn_hydrolase 5..214 CDD:294319 70/216 (32%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 73/239 (31%)
proteasome_alpha_type_1 6..215 CDD:239718 70/217 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441082
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.