DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosalpha6

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:140/270 - (51%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68
            :||..||::||.|.|.|||||.|||:.|:..:||:..:..|:....:...:|.:.:  |||..:|
  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ--RKIIPID 67

  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133
            ||:.::.:|||||||:|....:.|..:::.:::....|..:...:....|..||...|||:|:..
  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132

  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEIL-TIADEAAAIKHIVRT 197
            ||.|:||.| ||::|..||..|:..:||:.|..||..|.|:||:.::.| :..||  .|:|.:|.
  Fly   133 LVAGYDERG-PHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDE--IIRHGIRA 194

  Fly   198 LVSV-------SSLNHTQMEVAVLKYRQPLRMID------HQVLA--DLERTVRREIEDE----- 242
            ::..       .......:.||::...||..::.      |..:|  :...|.|.:.:|:     
  Fly   195 ILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDDDDDRPSPP 259

  Fly   243 AEASRRPRAP 252
            .|.:..||.|
  Fly   260 EEPAAGPRDP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 73/217 (34%)
Ntn_hydrolase 5..214 CDD:294319 73/216 (34%)
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 75/230 (33%)
proteasome_alpha_type_1 6..219 CDD:239718 73/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.