DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T2 and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:189 Identity:33/189 - (17%)
Similarity:77/189 - (40%) Gaps:15/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TVMGLRTNNAIVIG---VEKRSVGDLQEERMVRKICMLDDHVVMTFSGLTAD----ARILVSRAQ 90
            |::|::..:.:::.   ::.:|:..:::::  .||..|.|..:|...|...|    ...:.....
  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQ--SKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67

  Fly    91 MEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFDEDGTPHLFQTDPSGIF 155
            :...||..:....:...:..:.:|    :|.::|.|  :.::.|:.|:|....|.|...|..|..
  Fly    68 LYKISHGYHLSAKSAAHFTRKTLA----DYIRTNTR--YQVAMLLAGYDAVEGPDLHYIDSYGAA 126

  Fly   156 YEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTLVSVSSLNHTQMEVAVL 214
            ........|..|......::::.:..|:..|..:.:|..|..:.....:|....||.|:
  Fly   127 QSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 33/189 (17%)
Ntn_hydrolase 5..214 CDD:294319 32/187 (17%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 33/189 (17%)
proteasome_beta_type_2 3..194 CDD:239727 33/189 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.